Structure of PDB 8trq Chain B Binding Site BS01

Receptor Information
>8trq Chain B (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTE
LGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVY
PAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGD
WTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRAGS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8trq T cell recognition of citrullinated alpha-enolase peptide presented by HLA-DR4
Resolution2.75 Å
Binding residue
(original residue number in PDB)
E9 H13 F26 Y30 D57 Y60 W61 Q70 K71 Y78 H81 N82 V85
Binding residue
(residue number reindexed from 1)
E7 H11 F24 Y28 D55 Y58 W59 Q68 K69 Y76 H79 N80 V83
External links
PDB RCSB:8trq, PDBe:8trq, PDBj:8trq
PDBsum8trq
PubMed39043656
UniProtP01911|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]