Structure of PDB 8tof Chain B Binding Site BS01

Receptor Information
>8tof Chain B (length=385) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VYEATPFDPITVKPSDKRRVAYFYDADVGNYAYGAGHPMKPHRIRMAHSL
IMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRES
VKFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCDVAVNYAGGLHH
AKKSEASGFCYLNDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTD
RVMTCSFHKYGEFFPGTGELRDIGVGAGKNYAVNVPLRDGIDDATYRSVF
EPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNYVKSF
GIPMMVVGGGGYTMRNVARTWCFETGLLNNVVLDKDLPYNEYYEYYGPDY
KLSVRPSNMFNVNTPEYLDKVMTNIFANLENTKYA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tof Structure of the complete Saccharomyces cerevisiae Rpd3S-nucleosome complex.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		G37 P39 D109 F160 H188 F215 Y313
Binding residue
(residue number reindexed from 1)		G36 P38 D108 F159 H187 F214 Y312
Enzymatic activity
Enzyme Commision number 3.5.1.98: histone deacetylase.
Gene Ontology
Molecular Function
GO:0003713 transcription coactivator activity
GO:0003714 transcription corepressor activity
GO:0004407 histone deacetylase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
Biological Process
GO:0000082 G1/S transition of mitotic cell cycle
GO:0000086 G2/M transition of mitotic cell cycle
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006368 transcription elongation by RNA polymerase II
GO:0006979 response to oxidative stress
GO:0006995 cellular response to nitrogen starvation
GO:0016239 positive regulation of macroautophagy
GO:0016479 negative regulation of transcription by RNA polymerase I
GO:0030174 regulation of DNA-templated DNA replication initiation
GO:0031507 heterochromatin formation
GO:0034503 protein localization to nucleolar rDNA repeats
GO:0034605 cellular response to heat
GO:0044804 nucleophagy
GO:0045128 negative regulation of reciprocal meiotic recombination
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051321 meiotic cell cycle
GO:0061186 negative regulation of silent mating-type cassette heterochromatin formation
GO:0061188 negative regulation of rDNA heterochromatin formation
GO:0070550 rDNA chromatin condensation
Cellular Component
GO:0000118 histone deacetylase complex
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0032221 Rpd3S complex
GO:0033698 Rpd3L complex
GO:0034399 nuclear periphery
GO:0070210 Rpd3L-Expanded complex
GO:0070211 Snt2C complex
GO:0070822 Sin3-type complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8tof, PDBe:8tof, PDBj:8tof
PDBsum8tof
PubMed38065958
UniProtP32561|RPD3_YEAST Histone deacetylase RPD3 (Gene Name=RPD3)

[Back to BioLiP]