Structure of PDB 8tlq Chain B Binding Site BS01

Receptor Information
>8tlq Chain B (length=248) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVYTREAYFHEKAHGQTLQDQILKDQYKDQISSQSSKIFKNCVIYINGYT
KPGRLQLHEMIVLHGGKFLHYLSSKKTVTHIVASNLPLKKRIEFANYKVV
SPDWIVDSVKEARLLPWQNYSLTSKNHFMGQNSIFQPIKFQNLTRFKKIC
QLVKQWVAETLGDGGPHEKDVKLFVKYLIKLCDSNRVHLVLHLSNLISRE
LNLCAFLNQDHSGFQTWERILLNDIIPLLNRNKHTYQTVRKLDMDFEV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tlq Cryo-EM structure of the Rev1-Pol zeta holocomplex reveals the mechanism of their cooperativity in translesion DNA synthesis.
Resolution3.53 Å
Binding residue
(original residue number in PDB)		K202 K203
Binding residue
(residue number reindexed from 1)		K75 K76
Enzymatic activity
Enzyme Commision number 2.7.7.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003887 DNA-directed DNA polymerase activity
GO:0005515 protein binding
GO:0016779 nucleotidyltransferase activity
GO:0017125 deoxycytidyl transferase activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0042276 error-prone translesion synthesis
GO:0070987 error-free translesion synthesis
GO:0071897 DNA biosynthetic process
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005657 replication fork
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8tlq, PDBe:8tlq, PDBj:8tlq
PDBsum8tlq
PubMed38720088
UniProtP12689|REV1_YEAST DNA repair protein REV1 (Gene Name=REV1)

[Back to BioLiP]