Structure of PDB 8tlk Chain B Binding Site BS01

Receptor Information
>8tlk Chain B (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTLPHIIRPVEEITEEELENVCSNSREKIYNRSLGSTCHQCRQKTIDTKT
NCRNPDCWGVRGQFCGPCLRNRYGEEVRDALLDPNWHCPPCRGICNCSFC
R
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tlk The ICF syndrome protein CDCA7 harbors a unique DNA-binding domain that recognizes a CpG dyad in the context of a non-B DNA.
Resolution2.99 Å
Binding residue
(original residue number in PDB)		V233 T234 L235 R258 R264 T269 R274 Q275 K276 W290 G291 V292
Binding residue
(residue number reindexed from 1)		V1 T2 L3 R26 R32 T37 R42 Q43 K44 W58 G59 V60
External links
PDB RCSB:8tlk, PDBe:8tlk, PDBj:8tlk
PDBsum8tlk
PubMed38168392
UniProtQ9BWT1|CDCA7_HUMAN Cell division cycle-associated protein 7 (Gene Name=CDCA7)

[Back to BioLiP]