Structure of PDB 8tlj Chain B Binding Site BS01

Receptor Information
>8tlj Chain B (length=104) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMTLPHIIRPVEEVTEEEIRNICSNSREKIYNRSLGSTCHQCRQKTTDTK
TNCRNPDCWGIRGQFCGPCLRNRYGEEVKDALLDPNWHCPPCRGICNCSF
CRQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tlj The ICF syndrome protein CDCA7 harbors a unique DNA-binding domain that recognizes a CpG dyad in the context of a non-B DNA.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		T245 L246 S268 R269 R275 T280 R285 Q286 K287 W301 G302 I303
Binding residue
(residue number reindexed from 1)		T3 L4 S26 R27 R33 T38 R43 Q44 K45 W59 G60 I61
External links
PDB RCSB:8tlj, PDBe:8tlj, PDBj:8tlj
PDBsum8tlj
PubMed38168392
UniProtQ9D0M2|CDCA7_MOUSE Cell division cycle-associated protein 7 (Gene Name=Cdca7)

[Back to BioLiP]