Structure of PDB 8tg7 Chain B Binding Site BS01

Receptor Information
>8tg7 Chain B (length=66) Species: 2681611 (Escherichia phage Lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DITPVNDETMQEINTLLIALDKTWDDDLLPLCSQIFRRDIRASSELTQAE
AVKALGFLKQKAAEQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tg7 Structural basis for the interaction of Red-beta single strand annealing protein with Escherichia coli single stranded DNA binding protein.
Resolution1.775 Å
Binding residue
(original residue number in PDB)
K214 D219 I227 F228 R229 F249 L250 K253
Binding residue
(residue number reindexed from 1)
K22 D27 I35 F36 R37 F57 L58 K61
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8tg7, PDBe:8tg7, PDBj:8tg7
PDBsum8tg7
PubMed38663547
UniProtP03698|VBET_LAMBD Recombination protein bet (Gene Name=bet)

[Back to BioLiP]