Structure of PDB 8tfu Chain B Binding Site BS01

Receptor Information
>8tfu Chain B (length=69) Species: 2681611 (Escherichia phage Lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RDITPVNDETMQEINTLLIALDKTWDDDLLPLCSQIFRRDIRASSELTQA
EAVKALGFLKQKAAEQKVA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tfu Structural basis for the interaction of Red-beta single strand annealing protein with Escherichia coli single stranded DNA binding protein.
Resolution1.482 Å
Binding residue
(original residue number in PDB)		K214 D219 L223 I227 F228 R229 F249 K253
Binding residue
(residue number reindexed from 1)		K23 D28 L32 I36 F37 R38 F58 K62
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8tfu, PDBe:8tfu, PDBj:8tfu
PDBsum8tfu
PubMed38663547
UniProtP03698|VBET_LAMBD Recombination protein bet (Gene Name=bet)

[Back to BioLiP]