Structure of PDB 8tdx Chain B Binding Site BS01

Receptor Information
>8tdx Chain B (length=223) Species: 9544 (Macaca mulatta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLQESGPGVVKPSETLSLTCEVSLRVGSYYWSWIRQSQGQRPEWMGGLY
SDTGNTDYNPSLKSRVSLSRDMSKKQFFLNLRSVTATDTAVYFCVSRYVD
HWTNRRFDVWGPGAQVTVTSASTKGPSVFPLAPSSRSTSESTAALGCLVK
DYFPEPVTVSWNSGSLTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YVCNVNHKPSNTKVDKRVEIKTC
Ligand information
>8tdx Chain F (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tdx Broad and potent HIV-1 neutralization in fusion peptide-primed SHIV-boosted macaques
Resolution2.09 Å
Binding residue
(original residue number in PDB)		V31 G32 S33 Y34 Y35 Y54 R101 Y102 V103 H105 R110
Binding residue
(residue number reindexed from 1)		V27 G28 S29 Y30 Y31 Y50 R97 Y98 V99 H101 R106
External links