Structure of PDB 8tac Chain B Binding Site BS01

Receptor Information
>8tac Chain B (length=66) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GMTPEEIAEAKRIGKEVKERRKELGLTQRELAEKLGVSRSTVSDIENGRR
LPSEELLKKIKEILGV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tac Designed DNA binding protein
Resolution2.34 Å
Binding residue
(original residue number in PDB)		R20 T26 Q27 R38 S39 S42
Binding residue
(residue number reindexed from 1)		R21 T27 Q28 R39 S40 S43
External links