Structure of PDB 8t72 Chain B Binding Site BS01

Receptor Information
>8t72 Chain B (length=156) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGET
CLLDILDTAGYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVP
MVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLV
REIRQY
Ligand information
Ligand IDGNP
InChIInChI=1S/C10H17N6O13P3/c11-10-13-7-4(8(19)14-10)12-2-16(7)9-6(18)5(17)3(28-9)1-27-32(25,26)29-31(23,24)15-30(20,21)22/h2-3,5-6,9,17-18H,1H2,(H,25,26)(H3,11,13,14,19)(H4,15,20,21,22,23,24)/t3-,5-,6-,9-/m1/s1
InChIKeyUQABYHGXWYXDTK-UUOKFMHZSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04O=P(O)(O)NP(=O)(O)OP(=O)(O)OCC3OC(n2cnc1c2N=C(N)NC1=O)C(O)C3O
OpenEye OEToolkits 1.5.0c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@](=O)(O)O[P@@](=O)(NP(=O)(O)O)O)O)O)N=C(NC2=O)N
OpenEye OEToolkits 1.5.0c1nc2c(n1C3C(C(C(O3)COP(=O)(O)OP(=O)(NP(=O)(O)O)O)O)O)N=C(NC2=O)N
CACTVS 3.341NC1=Nc2n(cnc2C(=O)N1)[C@@H]3O[C@H](CO[P@@](O)(=O)O[P@@](O)(=O)N[P](O)(O)=O)[C@@H](O)[C@H]3O
CACTVS 3.341NC1=Nc2n(cnc2C(=O)N1)[CH]3O[CH](CO[P](O)(=O)O[P](O)(=O)N[P](O)(O)=O)[CH](O)[CH]3O
FormulaC10 H17 N6 O13 P3
NamePHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
ChEMBLCHEMBL1233085
DrugBankDB02082
ZINCZINC000037868676
PDB chain8t72 Chain B Residue 201 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t72 Comparative analysis of KRAS4a and KRAS4b splice variants reveals distinctive structural and functional properties
Resolution1.6 Å
Binding residue
(original residue number in PDB)
G13 G15 K16 S17 A18 F28 V29 D30 T35 G60 N116 K117 D119 L120 S145 A146 K147
Binding residue
(residue number reindexed from 1)
G13 G15 K16 S17 A18 F28 V29 D30 T35 G60 N106 K107 D109 L110 S135 A136 K137
Annotation score3
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0043495 protein-membrane adaptor activity
GO:0044877 protein-containing complex binding
Biological Process
GO:0000165 MAPK cascade
GO:0001934 positive regulation of protein phosphorylation
GO:0007165 signal transduction
GO:0007265 Ras protein signal transduction
GO:0008283 cell population proliferation
GO:0008542 visual learning
GO:0010467 gene expression
GO:0010628 positive regulation of gene expression
GO:0014009 glial cell proliferation
GO:0016601 Rac protein signal transduction
GO:0021897 forebrain astrocyte development
GO:0030036 actin cytoskeleton organization
GO:0030857 negative regulation of epithelial cell differentiation
GO:0032228 regulation of synaptic transmission, GABAergic
GO:0035022 positive regulation of Rac protein signal transduction
GO:0035914 skeletal muscle cell differentiation
GO:0043524 negative regulation of neuron apoptotic process
GO:0048169 regulation of long-term neuronal synaptic plasticity
GO:0048873 homeostasis of number of cells within a tissue
GO:0051146 striated muscle cell differentiation
GO:0051402 neuron apoptotic process
GO:0060252 positive regulation of glial cell proliferation
GO:0060441 epithelial tube branching involved in lung morphogenesis
GO:0060509 type I pneumocyte differentiation
Cellular Component
GO:0000139 Golgi membrane
GO:0005737 cytoplasm
GO:0005741 mitochondrial outer membrane
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0009898 cytoplasmic side of plasma membrane
GO:0012505 endomembrane system
GO:0016020 membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8t72, PDBe:8t72, PDBj:8t72
PDBsum8t72
PubMed38354232
UniProtP01116|RASK_HUMAN GTPase KRas (Gene Name=KRAS)

[Back to BioLiP]