Structure of PDB 8t65 Chain B Binding Site BS01

Receptor Information
>8t65 Chain B (length=153) Species: 472759 (Nitrosococcus halophilus Nc 4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FPRVGGVSESTVQWEGVVFTVSNESVPRWVMAQIQPAYMGLVATQASLAA
AEAVAAVARRRGIEVHGPLQVADPNDPAASRSQVALLLSELRRAGCREIA
VDLTGGKLPMSLGAFMAAEEAGVASLYVATDFDKHLKVPDMRTATLRQIS
QPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t65 The CRISPR effector Cam1 mediates membrane depolarization for phage defence.
Resolution2.09 Å
Binding residue
(original residue number in PDB)		S75 V79 T97 T157 G159 K160 L161 Y180 F185 L189 P192 M194
Binding residue
(residue number reindexed from 1)		S22 V26 T44 T104 G106 K107 L108 Y127 F132 L136 P139 M141
Enzymatic activity
Enzyme Commision number ?
External links