Structure of PDB 8t5p Chain B Binding Site BS01

Receptor Information
>8t5p Chain B (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKR
RKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVI
MRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGE
MNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPD
Ligand information
>8t5p Chain H (length=5) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PIQAS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t5p SARS-CoV-2 ORF3a-Mediated NF-kappa B Activation Is Not Dependent on TRAF-Binding Sequence
Resolution2.5 Å
Binding residue
(original residue number in PDB)		D462 I529 A530 S531 G532
Binding residue
(residue number reindexed from 1)		D86 I153 A154 S155 G156
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0001817 regulation of cytokine production
GO:0008063 Toll signaling pathway
GO:0032088 negative regulation of NF-kappaB transcription factor activity
GO:0033209 tumor necrosis factor-mediated signaling pathway
GO:0045087 innate immune response
GO:0050688 regulation of defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8t5p, PDBe:8t5p, PDBj:8t5p
PDBsum8t5p
PubMed38005906
UniProtQ13114|TRAF3_HUMAN TNF receptor-associated factor 3 (Gene Name=TRAF3)

[Back to BioLiP]