Structure of PDB 8t59 Chain B Binding Site BS01

Receptor Information
>8t59 Chain B (length=218) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVVMTQSPLSLPVTPGEPASISCRSSRSLLTSKGITSLYWYLQKPGQSPQ
LLIYRMSNLASGIPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQFLVYP
YTFGPGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK
VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t59 Rapid affinity optimization of an anti-TREM2 clinical lead antibody by cross-lineage immune repertoire mining
Resolution2.0 Å
Binding residue
(original residue number in PDB)		S32 S37 Y39 R55 F96 L97 Y101
Binding residue
(residue number reindexed from 1)		S32 S37 Y39 R55 F96 L97 Y101
External links