Structure of PDB 8t4g Chain B Binding Site BS01

Receptor Information
>8t4g Chain B (length=551) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDIL
GGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINLRIREQLF
SSLLRQDLGFFQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVG
LYGFMLSISPRLTLLSLLHMPFTIAAEKVYNTRHQEVLREIQDAVARAGQ
VVREAVGGLQTVRSFGAEEHEVCRYKEALEQCRQLYWRRDLERALYLLVR
RVLHLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVGSYVQTLVYIY
GDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNR
PDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLD
EKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAA
QAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLIL
DEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKL
Q
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t4g Transporter associated with antigen processing (TAP) bound to the 9-mer peptide QYDDAVYKL
Resolution3.5 Å
Binding residue
(original residue number in PDB)		T215 P265 L266 N269 R273 L377 T425 Y428
Binding residue
(residue number reindexed from 1)		T85 P135 L136 N139 R143 L247 T295 Y298
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0015433 ABC-type peptide antigen transporter activity
GO:0015440 ABC-type peptide transporter activity
GO:0023029 MHC class Ib protein binding
GO:0042605 peptide antigen binding
GO:0046872 metal ion binding
GO:0046978 TAP1 binding
GO:0046980 tapasin binding
GO:1904680 peptide transmembrane transporter activity
Biological Process
GO:0001913 T cell mediated cytotoxicity
GO:0001916 positive regulation of T cell mediated cytotoxicity
GO:0002237 response to molecule of bacterial origin
GO:0002250 adaptive immune response
GO:0002481 antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent
GO:0002485 antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent
GO:0002489 antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent
GO:0015031 protein transport
GO:0015833 peptide transport
GO:0019885 antigen processing and presentation of endogenous peptide antigen via MHC class I
GO:0046967 cytosol to endoplasmic reticulum transport
GO:0046968 peptide antigen transport
GO:0055085 transmembrane transport
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane
GO:0016607 nuclear speck
GO:0030670 phagocytic vesicle membrane
GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0042824 MHC class I peptide loading complex
GO:0042825 TAP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8t4g, PDBe:8t4g, PDBj:8t4g
PDBsum8t4g
PubMed
UniProtQ03519|TAP2_HUMAN Antigen peptide transporter 2 (Gene Name=TAP2)

[Back to BioLiP]