Structure of PDB 8t4f Chain B Binding Site BS01

Receptor Information
>8t4f Chain B (length=548) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDIL
GDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINLRIREQLFSSL
LRQDLGFFQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVGLYG
FMLSISPRLTLLSLLHMPFTIAAEKVYNTRHQEVLREIQDAVARAGQVVR
EAVGGLQTVRSFGAEEHEVCRYKEALEQCRQLYWRRDLERALYLLVRRVL
HLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVGSYVQTLVYIYGDM
LSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDR
PVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKP
ISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAA
HADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEA
TSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t4f Transporter associated with antigen processing (TAP) bound to the 9-mer peptide RRYQKSTEL
Resolution3.5 Å
Binding residue
(original residue number in PDB)		T215 M218 N269 R273 R373
Binding residue
(residue number reindexed from 1)		T82 M85 N136 R140 R240
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0015433 ABC-type peptide antigen transporter activity
GO:0015440 ABC-type peptide transporter activity
GO:0023029 MHC class Ib protein binding
GO:0042605 peptide antigen binding
GO:0046872 metal ion binding
GO:0046978 TAP1 binding
GO:0046980 tapasin binding
GO:1904680 peptide transmembrane transporter activity
Biological Process
GO:0001913 T cell mediated cytotoxicity
GO:0001916 positive regulation of T cell mediated cytotoxicity
GO:0002237 response to molecule of bacterial origin
GO:0002250 adaptive immune response
GO:0002481 antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent
GO:0002485 antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent
GO:0002489 antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent
GO:0015031 protein transport
GO:0015833 peptide transport
GO:0019885 antigen processing and presentation of endogenous peptide antigen via MHC class I
GO:0046967 cytosol to endoplasmic reticulum transport
GO:0046968 peptide antigen transport
GO:0055085 transmembrane transport
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane
GO:0016607 nuclear speck
GO:0030670 phagocytic vesicle membrane
GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0042824 MHC class I peptide loading complex
GO:0042825 TAP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8t4f, PDBe:8t4f, PDBj:8t4f
PDBsum8t4f
PubMed
UniProtQ03519|TAP2_HUMAN Antigen peptide transporter 2 (Gene Name=TAP2)

[Back to BioLiP]