Structure of PDB 8t0p Chain B Binding Site BS01

Receptor Information
>8t0p Chain B (length=107) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSSSITSVTTIDVLSSLFINLFENDLIPQALKDFNKSDDDQFRKLLYKLD
LRLFQTISDQMTRDLKDILDINVSNNELCYQLKQVLARKEDLNQQIISVR
NEIQELK
Ligand information
>8t0p Chain C (length=18) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QSINDRALSLLQRTRATK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t0p Molecular basis of Cse4 recognition by Ame1-Okp1 complex
Resolution1.73 Å
Binding residue
(original residue number in PDB)		D188 D191 D194 I195 S198
Binding residue
(residue number reindexed from 1)		D64 D67 D70 I71 S74
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8t0p, PDBe:8t0p, PDBj:8t0p
PDBsum8t0p
PubMed37983946
UniProtP38313|CENPU_YEAST Inner kinetochore subunit AME1 (Gene Name=AME1)

[Back to BioLiP]