Structure of PDB 8st0 Chain B Binding Site BS01

Receptor Information
>8st0 Chain B (length=384) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQ
IMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADG
MYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRS
WTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDIT
YDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLA
LTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRS
PTTHTMAPWVKVVFLEKLPALLFMQQPRHHGCGLREAVDGVRFIADHMRS
EDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGT
Ligand information
Ligand IDACH
InChIInChI=1S/C7H16NO2/c1-7(9)10-6-5-8(2,3)4/h5-6H2,1-4H3/q+1
InChIKeyOIPILFWXSMYKGL-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04O=C(OCC[N+](C)(C)C)C
CACTVS 3.341
OpenEye OEToolkits 1.5.0		CC(=O)OCC[N+](C)(C)C
FormulaC7 H16 N O2
NameACETYLCHOLINE
ChEMBLCHEMBL667
DrugBankDB03128
ZINCZINC000003079336
PDB chain8st0 Chain A Residue 702 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8st0 Structure of the 2alpha3beta stoichiometry of the full-length human alpha4beta2 nicotinic receptor in complex with acetylcholine
Resolution2.4 Å
Binding residue
(original residue number in PDB)		W57 L121
Binding residue
(residue number reindexed from 1)		W57 L121
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0005216 monoatomic ion channel activity
GO:0005230 extracellular ligand-gated monoatomic ion channel activity
GO:0005515 protein binding
GO:0015276 ligand-gated monoatomic ion channel activity
GO:0015464 acetylcholine receptor activity
GO:0022848 acetylcholine-gated monoatomic cation-selective channel activity
GO:0042166 acetylcholine binding
GO:0044877 protein-containing complex binding
GO:0050997 quaternary ammonium group binding
GO:1901363 heterocyclic compound binding
GO:1904315 transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
Biological Process
GO:0001666 response to hypoxia
GO:0006811 monoatomic ion transport
GO:0006816 calcium ion transport
GO:0006939 smooth muscle contraction
GO:0007154 cell communication
GO:0007165 signal transduction
GO:0007271 synaptic transmission, cholinergic
GO:0007601 visual perception
GO:0007605 sensory perception of sound
GO:0007612 learning
GO:0007613 memory
GO:0007626 locomotory behavior
GO:0008306 associative learning
GO:0008542 visual learning
GO:0014059 regulation of dopamine secretion
GO:0019233 sensory perception of pain
GO:0021562 vestibulocochlear nerve development
GO:0021631 optic nerve morphogenesis
GO:0021771 lateral geniculate nucleus development
GO:0021952 central nervous system projection neuron axonogenesis
GO:0023052 signaling
GO:0030890 positive regulation of B cell proliferation
GO:0032225 regulation of synaptic transmission, dopaminergic
GO:0033603 positive regulation of dopamine secretion
GO:0034220 monoatomic ion transmembrane transport
GO:0035094 response to nicotine
GO:0035095 behavioral response to nicotine
GO:0035176 social behavior
GO:0042053 regulation of dopamine metabolic process
GO:0042113 B cell activation
GO:0042220 response to cocaine
GO:0042320 regulation of circadian sleep/wake cycle, REM sleep
GO:0045471 response to ethanol
GO:0045759 negative regulation of action potential
GO:0048814 regulation of dendrite morphogenesis
GO:0050877 nervous system process
GO:0050890 cognition
GO:0051899 membrane depolarization
GO:0051963 regulation of synapse assembly
GO:0060078 regulation of postsynaptic membrane potential
GO:0060079 excitatory postsynaptic potential
GO:0060084 synaptic transmission involved in micturition
GO:0095500 acetylcholine receptor signaling pathway
GO:1905144 response to acetylcholine
Cellular Component
GO:0005886 plasma membrane
GO:0005892 acetylcholine-gated channel complex
GO:0009897 external side of plasma membrane
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0042734 presynaptic membrane
GO:0043005 neuron projection
GO:0044853 plasma membrane raft
GO:0045202 synapse
GO:0045211 postsynaptic membrane
GO:0098981 cholinergic synapse
GO:0099634 postsynaptic specialization membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8st0, PDBe:8st0, PDBj:8st0
PDBsum8st0
PubMed38454578
UniProtP17787|ACHB2_HUMAN Neuronal acetylcholine receptor subunit beta-2 (Gene Name=CHRNB2)

[Back to BioLiP]