Structure of PDB 8sii Chain B Binding Site BS01

Receptor Information
>8sii Chain B (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMA
YEEKEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8sii Crystal Structure of CBX7 with compound UNC4976
Resolution1.37 Å
Binding residue
(original residue number in PDB)		Q9 V10 F11 A12 V13 W32 W35 Y39 E43 H47 L49 D50 R52 L53
Binding residue
(residue number reindexed from 1)		Q3 V4 F5 A6 V7 W26 W29 Y33 E37 H41 L43 D44 R46 L47
External links
PDB RCSB:8sii, PDBe:8sii, PDBj:8sii
PDBsum8sii
PubMed
UniProtO95931|CBX7_HUMAN Chromobox protein homolog 7 (Gene Name=CBX7)

[Back to BioLiP]