Structure of PDB 8sb6 Chain B Binding Site BS01

Receptor Information
>8sb6 Chain B (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGT
IKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQ
KVASMPQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8sb6 Acetyl-methyllysine marks chromatin at active transcription start sites.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
D112 Y155 N156 K157 D160
Binding residue
(residue number reindexed from 1)
D37 Y80 N81 K82 D85
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8sb6, PDBe:8sb6, PDBj:8sb6
PDBsum8sb6
PubMed37731000
UniProtP25440|BRD2_HUMAN Bromodomain-containing protein 2 (Gene Name=BRD2)

[Back to BioLiP]