Structure of PDB 8s9x Chain B Binding Site BS01

Receptor Information
>8s9x Chain B (length=185) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KNLYHYHQYEITLESAVDSCKNHLQAAIGLLYSPQKCELVKLDNSGKLVD
SYNRLKFNNLGVFEARFFNLNCELRWVNESNGNGTAVLLSESDITLTGFE
KGLQEFITAIDQQYLLWGEPAKHPPNADGWQRLAEARIGKLDIPLDNPLK
PKDRVFLTSEEYIAEVDDFGNCAVIDERLIKLEVK
Ligand information
>8s9x Chain F (length=37) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acugaaacuguaguagaaccaaucggggucgucaaua
.....................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8s9x RNA targeting and cleavage by the type III-Dv CRISPR effector complex.
Resolution3.44 Å
Binding residue
(original residue number in PDB)		F71 N86 R145
Binding residue
(residue number reindexed from 1)		F63 N78 R137
Enzymatic activity
Enzyme Commision number ?
External links