Structure of PDB 8s4t Chain B Binding Site BS01

Receptor Information
>8s4t Chain B (length=136) Species: 1351 (Enterococcus faecalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKYERPLKRESQIKEFELGTHAAVIEKVQKKRSQKGNDMFLLSLLGKSNE
KGVYFLTFGNDYTEDNLRYILASIQDNGVEIPDVDFGYNRETFEFLKGKD
VYIQVEEQEYKGKVKHAVTNFLTQDEFEESEEMEFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8s4t ssDNA-binding protein PrgE and its role in Enterococcal conjugation
Resolution2.67 Å
Binding residue
(original residue number in PDB)		S33 Q34 K35 N37 M39 T57 N60 Y62 Q108 Y110
Binding residue
(residue number reindexed from 1)		S33 Q34 K35 N37 M39 T57 N60 Y62 Q108 Y110
Enzymatic activity
Enzyme Commision number ?
External links