Structure of PDB 8qu4 Chain B Binding Site BS01

Receptor Information
>8qu4 Chain B (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCH
QEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qu4 Binding dynamics of a stapled peptide targeting the transcription factor NF-Y.
Resolution1.38 Å
Binding residue
(original residue number in PDB)		I57 E92 S95 F96 S99 E100 E103 L125 F127
Binding residue
(residue number reindexed from 1)		I1 E36 S39 F40 S43 E44 E47 L69 F71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043565 sequence-specific DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0016602 CCAAT-binding factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qu4, PDBe:8qu4, PDBj:8qu4
PDBsum8qu4
PubMed38470946
UniProtP25208|NFYB_HUMAN Nuclear transcription factor Y subunit beta (Gene Name=NFYB)

[Back to BioLiP]