Structure of PDB 8qqi Chain B Binding Site BS01

Receptor Information
>8qqi Chain B (length=399) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKIL
NVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADV
DGSHIRTLLLTFFYRQMPEIVERGHVYIAQPPLYKVKKGKQEQYIKDDEA
MDQYQISIALDGATLHTNASAPALAGEALEKLVSEYNATQKMINRMERRY
PKAMLKELIYQPTLTEADLSDEQTVTRWVNALVSELNDKEQHGSQWKFDV
HTNAEQNLFEPIVRVRTHGVDTDYPLDHEFITGGEYRRICTLGEKLRGLL
EEDAFIERGERRQPVASFEQALDWLVKESRRGLSIQRYKGLGEMNPEQLW
ETTMDPESRRMLRVTVKDAIAADQLFTTLMGDAVEPRRAFIEENALKAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qqi Discovery of isoquinoline sulfonamides as allosteric gyrase inhibitors with activity against fluoroquinolone-resistant bacteria.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		N452 K455 H505 V785 R788
Binding residue
(residue number reindexed from 1)		N51 K54 H104 V384 R387
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003916 DNA topoisomerase activity
GO:0003918 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0034335 DNA negative supercoiling activity
GO:0046872 metal ion binding
Biological Process
GO:0006261 DNA-templated DNA replication
GO:0006265 DNA topological change
GO:0006351 DNA-templated transcription
GO:0009410 response to xenobiotic stimulus
GO:0046677 response to antibiotic
GO:0051276 chromosome organization
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0009330 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qqi, PDBe:8qqi, PDBj:8qqi
PDBsum8qqi
PubMed38898213
UniProtP0AES6|GYRB_ECOLI DNA gyrase subunit B (Gene Name=gyrB)

[Back to BioLiP]