Structure of PDB 8pjg Chain B Binding Site BS01

Receptor Information

>8pjg Chain B (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVT
VYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQN
GDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA

Ligand information

>8pjg Chain C (length=13) Species: 11320 (Influenza A virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PKYVKQNTLKLAR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8pjg A targeted single mutation in influenza A virus universal epitope transforms immunogenicity and protective immunity via CD4 + T cell activation.
Resolution	1.83 Å
Binding residue (original residue number in PDB)	L11 F13 D57 Y60 W61 R71 Y78 H81 N82 V85
Binding residue (residue number reindexed from 1)	L11 F13 D57 Y60 W61 R71 Y78 H81 N82 V85

External links

PDB	RCSB:8pjg, PDBe:8pjg, PDBj:8pjg
PDBsum	8pjg
PubMed	38819988
UniProt	P01911\|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]