Structure of PDB 8pjf Chain B Binding Site BS01

Receptor Information

>8pjf Chain B (length=191) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRA
VTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKV
TVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQ
NGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA

Ligand information

>8pjf Chain C (length=13) Species: 11320 (Influenza A virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PKYVKQNTLKLAR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8pjf A targeted single mutation in influenza A virus universal epitope transforms immunogenicity and protective immunity via CD4 + T cell activation.
Resolution	1.48 Å
Binding residue (original residue number in PDB)	F13 E28 Y47 P56 D57 W61 L67 R71 Y78 H81 N82 V85
Binding residue (residue number reindexed from 1)	F14 E29 Y48 P57 D58 W62 L68 R72 Y79 H82 N83 V86

External links

PDB	RCSB:8pjf, PDBe:8pjf, PDBj:8pjf
PDBsum	8pjf
PubMed	38819988
UniProt	P01911\|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]