Structure of PDB 8pje Chain B Binding Site BS01

Receptor Information

>8pje Chain B (length=193) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSMGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEY
RAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEP
KVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGL
IQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA

Ligand information

>8pje Chain C (length=13) Species: 11320 (Influenza A virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PKYVKQNTLKLAT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8pje A targeted single mutation in influenza A virus universal epitope transforms immunogenicity and protective immunity via CD4 + T cell activation.
Resolution	1.7 Å
Binding residue (original residue number in PDB)	F13 E28 D57 W61 L67 R71 Y78 H81 N82 V85
Binding residue (residue number reindexed from 1)	F16 E31 D60 W64 L70 R74 Y81 H84 N85 V88

External links

PDB	RCSB:8pje, PDBe:8pje, PDBj:8pje
PDBsum	8pje
PubMed	38819988
UniProt	P01911\|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]