Structure of PDB 8pi7 Chain B Binding Site BS01

Receptor Information
>8pi7 Chain B (length=167) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGL
NQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHARNRFKWGPA
SQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLV
TEVRVYNWFANRRKEEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pi7 Molecular mechanism of HNF-1A-mediated HNF4A gene regulation and promoter-driven HNF4A-MODY diabetes.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		N140 S142 H143 Q146 P153 M154 K155 R203 F204 W206 R263 N266 N270
Binding residue
(residue number reindexed from 1)		N51 S53 H54 Q57 P64 M65 K66 R94 F95 W97 R154 N157 N161
External links
PDB RCSB:8pi7, PDBe:8pi7, PDBj:8pi7
PDBsum8pi7
PubMed38855865
UniProtP20823|HNF1A_HUMAN Hepatocyte nuclear factor 1-alpha (Gene Name=HNF1A)

[Back to BioLiP]