Structure of PDB 8p94 Chain B Binding Site BS01

Receptor Information

>8p94 Chain B (length=394) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNI
EIKDLMVGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNI
DTRNCKILLTEPPMNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQG
LLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLR
GYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGR
IIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKH
IVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRR
KHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR

Ligand information

>8p94 Chain a (length=7) Species: 67723 (Amanita phalloides) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

WLATCPA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8p94 Molecular visualization of how cortactin stabilizes Arp2/3-complex nucleated actin branches
Resolution	3.3 Å
Binding residue (original residue number in PDB)	E75 I78 P116 R181
Binding residue (residue number reindexed from 1)	E75 I78 P116 R181

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003779	actin binding
GO:0005200	structural constituent of cytoskeleton
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0051015	actin filament binding

	Biological Process
GO:0007163	establishment or maintenance of cell polarity
GO:0008356	asymmetric cell division
GO:0010592	positive regulation of lamellipodium assembly
GO:0016344	meiotic chromosome movement towards spindle pole
GO:0016482	cytosolic transport
GO:0030036	actin cytoskeleton organization
GO:0033206	meiotic cytokinesis
GO:0034314	Arp2/3 complex-mediated actin nucleation
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0051321	meiotic cell cycle
GO:0051653	spindle localization
GO:0060271	cilium assembly
GO:0071346	cellular response to type II interferon
GO:1905168	positive regulation of double-strand break repair via homologous recombination
GO:2001032	regulation of double-strand break repair via nonhomologous end joining

	Cellular Component
GO:0005576	extracellular region
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005885	Arp2/3 protein complex
GO:0005925	focal adhesion
GO:0005938	cell cortex
GO:0015629	actin cytoskeleton
GO:0016020	membrane
GO:0030478	actin cap
GO:0035578	azurophil granule lumen
GO:0035861	site of double-strand break
GO:0042995	cell projection
GO:0070062	extracellular exosome
GO:1904813	ficolin-1-rich granule lumen

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8p94, PDBe:8p94, PDBj:8p94
PDBsum	8p94
PubMed	38267598
UniProt	P61160\|ARP2_HUMAN Actin-related protein 2 (Gene Name=ACTR2)

[Back to BioLiP]