Structure of PDB 8ow1 Chain B Binding Site BS01

Receptor Information
>8ow1 Chain B (length=116) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EWKKQRKDSHKEVERRRRENINTAINVLSDLLPVRESSKAAILACAAEYI
QKLKETDEANIEKWTLQKLLSEQNASQLASANEKLQEELGNAYKEIEYMK
RVLRKEGIEYEDMHTH
Ligand information
>8ow1 Chain D (length=153) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ataagtcacatggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaatattagtgta
tttgatttccgaaagttaaaaaagaaatagtaagaaatatatatttcatt
gaa
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ow1 Cryo-EM structure of the complete inner kinetochore of the budding yeast point centromere.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		W219 V230
Binding residue
(residue number reindexed from 1)		W2 V13
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0019237 centromeric DNA binding
GO:0046983 protein dimerization activity
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006338 chromatin remodeling
GO:0006357 regulation of transcription by RNA polymerase II
GO:0007059 chromosome segregation
GO:0042762 regulation of sulfur metabolic process
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0061431 cellular response to methionine
GO:1900059 positive regulation of sulfate assimilation
GO:1900060 negative regulation of ceramide biosynthetic process
GO:1900090 positive regulation of inositol biosynthetic process
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005739 mitochondrion
GO:0089713 Cbf1-Met4-Met28 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ow1, PDBe:8ow1, PDBj:8ow1
PDBsum8ow1
PubMed37506202
UniProtP17106|CBF1_YEAST Centromere-binding protein 1 (Gene Name=CBF1)

[Back to BioLiP]