Structure of PDB 8osb Chain B Binding Site BS01

Receptor Information
>8osb Chain B (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKL
AARYIDFLYQVLQSDE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8osb DNA-guided transcription factor cooperativity shapes face and limb mesenchyme.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R110 N114 E117 R118 T121 N125 K145
Binding residue
(residue number reindexed from 1)		R9 N13 E16 R17 T20 N24 K44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:8osb, PDBe:8osb, PDBj:8osb
PDBsum8osb
PubMed38262408
UniProtQ15672|TWST1_HUMAN Twist-related protein 1 (Gene Name=TWIST1)

[Back to BioLiP]