Structure of PDB 8opt Chain B Binding Site BS01

Receptor Information
>8opt Chain B (length=42) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLK
Ligand information
>8opt Chain D (length=54) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuguacaguuugaggguauaugauacaacccgguacaggagauaacugua
cagg
<<<<<<.<<.<<..............................>>>>.>>>
>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8opt Structural basis for activity switching in polymerases determining the fate of let-7 pre-miRNAs
Resolution3.65 Å
Binding residue
(original residue number in PDB)		G136 Y140 A149 K150 E151 K159 C161 V171
Binding residue
(residue number reindexed from 1)		G1 Y5 A14 K15 E16 K24 C26 V36
Gene Ontology
Molecular Function
GO:0002151 G-quadruplex RNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0031369 translation initiation factor binding
GO:0035198 miRNA binding
GO:0046872 metal ion binding
GO:0070883 pre-miRNA binding
GO:0140517 protein-RNA adaptor activity
GO:1990825 sequence-specific mRNA binding
Biological Process
GO:0007281 germ cell development
GO:0010586 miRNA metabolic process
GO:0010587 miRNA catabolic process
GO:0010629 negative regulation of gene expression
GO:0017148 negative regulation of translation
GO:0019827 stem cell population maintenance
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0031054 pre-miRNA processing
GO:0031123 RNA 3'-end processing
GO:0032008 positive regulation of TOR signaling
GO:0045666 positive regulation of neuron differentiation
GO:0045686 negative regulation of glial cell differentiation
GO:0045727 positive regulation of translation
GO:0048863 stem cell differentiation
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0060964 regulation of miRNA-mediated gene silencing
GO:0071076 RNA 3' uridylation
GO:0071333 cellular response to glucose stimulus
GO:1901724 positive regulation of cell proliferation involved in kidney development
GO:2000632 negative regulation of pre-miRNA processing
GO:2000767 positive regulation of cytoplasmic translation
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005791 rough endoplasmic reticulum
GO:0005829 cytosol
GO:0010494 cytoplasmic stress granule

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8opt, PDBe:8opt, PDBj:8opt
PDBsum8opt
PubMed39054354
UniProtQ9H9Z2|LN28A_HUMAN Protein lin-28 homolog A (Gene Name=LIN28A)

[Back to BioLiP]