Structure of PDB 8oj6 Chain B Binding Site BS01

Receptor Information
>8oj6 Chain B (length=266) Species: 10306 (Human alphaherpesvirus 1 strain KOS) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAPCQVVLQGAELNGILQAFAPLRTSLLDSLLVMGDRGILIHNTIFGEQV
FLPLEHSQFSRYRWRGPTAAFLSLVDQKRSLLSVFRANQYPDLRRVELAI
TGQAPFRTLVQRIWTTTSDGEAVELASETLMKRELTSFVVLVPQGTPDVQ
LRLTRPQLTKVLNATGADSATPTTFELGVNGKFSVFTTSTCVTFAARENA
KTVYGENTHRTFSVVVDDCSMRAVLRRLQVGGGTLKFFLTTPVPSLCVTA
TGPNAVSAVFLLKPQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8oj6 Dynamics of the Herpes simplex virus DNA polymerase holoenzyme during DNA synthesis and proof-reading revealed by Cryo-EM
Resolution2.41 Å
Binding residue
(original residue number in PDB)		R51 T52
Binding residue
(residue number reindexed from 1)		R24 T25
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030337 DNA polymerase processivity factor activity
Biological Process
GO:0006260 DNA replication
GO:0039686 bidirectional double-stranded viral DNA replication
Cellular Component
GO:0042025 host cell nucleus
GO:0042575 DNA polymerase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oj6, PDBe:8oj6, PDBj:8oj6
PDBsum8oj6
PubMed38806233
UniProtP10226|PAP_HHV11 DNA polymerase processivity factor (Gene Name=UL42)

[Back to BioLiP]