Structure of PDB 8oel Chain B Binding Site BS01

Receptor Information

>8oel Chain B (length=178) Species: 29292 (Pyrococcus abyssi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KRMPATRLYIKDILEGYFVKSEGDFEPNYLITKYARKVYRAKIVGTVVRE
PLIAEDETYGKFQVDDGTGVIWVLGFRDDTKFAKLVRKGDLVQVIGKIAE
WRDDKQILVEGVSKVHPNMWILHRYETLKEKIEHIKKAKIALEIYNQYGI
TAKSKVIAKNKGIEEELLEVIDELYGIM

Ligand information

>8oel Chain T (length=28) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tttttttttttttttttttttttttttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8oel DNA-binding mechanism and evolution of replication protein A.
Resolution	8.2 Å
Binding residue (original residue number in PDB)	K3 R4 K22 D26 F27 E28 P29 R42 Y61 L76 F78 R79 K99 W103 Q108
Binding residue (residue number reindexed from 1)	K1 R2 K20 D24 F25 E26 P27 R40 Y59 L74 F76 R77 K97 W101 Q106

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding

	Cellular Component
GO:0000781	chromosome, telomeric region
GO:0005694	chromosome

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:8oel, PDBe:8oel, PDBj:8oel
PDBsum	8oel
PubMed	37087464
UniProt	Q9V1Z1

[Back to BioLiP]