Structure of PDB 8kfw Chain B Binding Site BS01

Receptor Information
>8kfw Chain B (length=163) Species: 4577 (Zea mays) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GWVIGVDPDIGGAIAVLSPDGSSQVFDNPFVHIVVSEVIRKRLDTKSIIQ
LLRGLDAPPGTTAYIEKSSPFPTDGKQGWWSTGFSYGLWIASLVASGFSV
VPIASQTWKAYFGLMRSETPADDSRQAASILFPDKDQSLKLKKHHGRAEA
LLLAAYGKGLVLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kfw MOC1 cleaves Holliday junctions through a cooperative nick and counter-nick mechanism mediated by metal ions.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		D117 I118 R148 K175 S177 F179 P180 D182 G186 W187 S189 A212 S213 Q214 K217 M223 R224 E257
Binding residue
(residue number reindexed from 1)		D9 I10 R40 K67 S69 F71 P72 D74 G78 W79 S81 A104 S105 Q106 K109 M115 R116 E149
External links