Structure of PDB 8kfs Chain B Binding Site BS01

Receptor Information
>8kfs Chain B (length=163) Species: 4577 (Zea mays) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GWVIGVDPDIGGAIAVLSPDGSSQVFDNPFVHIVVSEVIRKRLDTKSIIQ
LLRGLDAPPGTTAYIEKSSPFPTDGKQGWWSTGFSYGLWIASLVASGFSV
VPIASQTWKAYFGLMRSETPKDDSRQAASILFPDKDQSLKLKKHHGRAEA
LLLAAYGKGLVLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kfs MOC1 cleaves Holliday junctions through a cooperative nick and counter-nick mechanism mediated by metal ions.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		D117 I118 R148 R150 K175 F179 P180 D182 Q185 G186 W187 S189 A212 Q214 T215 K217 M223 R224
Binding residue
(residue number reindexed from 1)		D9 I10 R40 R42 K67 F71 P72 D74 Q77 G78 W79 S81 A104 Q106 T107 K109 M115 R116
External links