Structure of PDB 8k88 Chain B Binding Site BS01

Receptor Information

>8k88 Chain B (length=258) Species: 35554 (Geobacter sulfurreducens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GKSFPALRTNALPVVTQSIRCGVVTLASPITFSELKERISQKSPKALLTY
TEKVLFLGGEPEIRKIFSNDEINSIGQYYIDEIAQSVAASTFLKSFVEEA
ILTALLREKPILHRVRHRTHYAVIPNASAKDDRFLDLRKAVGFKGDLGYI
TGNVTNAKELSWAEAVSIRLEERGGKLWIMLKPEIWIKPLDRREEATDFI
RSRRRYRFNQCSYQILDAWIKILFGSIGGGGTVNISCFPDAEFKAEFEIG
TRTAFSLG

Ligand information

>8k88 Chain C (length=23) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

accgacgtctaagaaaccattat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8k88 Structural Basis of prokaryotic Argonaute System
Resolution	2.6 Å
Binding residue (original residue number in PDB)	K360 T415 F416 K418 R442 F532
Binding residue (residue number reindexed from 1)	K36 T91 F92 K94 R118 F208

Gene Ontology

	Molecular Function
GO:0003674	molecular_function

	Biological Process
GO:0008150	biological_process

	Cellular Component
GO:0005575	cellular_component

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8k88, PDBe:8k88, PDBj:8k88
PDBsum	8k88
PubMed	38923459
UniProt	Q74DF6

[Back to BioLiP]