Structure of PDB 8k86 Chain B Binding Site BS01

Receptor Information
>8k86 Chain B (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLS
LKLKFGLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8k86 Structural basis for specific DNA sequence recognition by the transcription factor NFIL3.
Resolution2.06 Å
Binding residue
(original residue number in PDB)
R89 S90
Binding residue
(residue number reindexed from 1)
R18 S19
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8k86, PDBe:8k86, PDBj:8k86
PDBsum8k86
PubMed38382670
UniProtQ16649|NFIL3_HUMAN Nuclear factor interleukin-3-regulated protein (Gene Name=NFIL3)

[Back to BioLiP]