Structure of PDB 8jrj Chain B Binding Site BS01

Receptor Information
>8jrj Chain B (length=177) Species: 29078 (Eptesicus fuscus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PAHFLYQVKFECQFSNGTERVRYLHRSIYNGQEDVRFDSDVGEFRALTEL
GRPRAEYWNSQKDYLEDERASVDTYCRHNYGVLDGFLVHRQTAPTVTVFP
AKNLLVCSVNGFYPGPIEVRWLRDEQAGVVSTGLIRNGDWTFQMLVMLET
VPRSGEVYTCHVQHPSSSSPVTVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jrj Crystal structure of the bat MHC II molecule at 2.8 A resolution
Resolution2.5 Å
Binding residue
(original residue number in PDB)		H61 R90 W94 Y100 E104 S107 Y111 H114 N115 V118 L119
Binding residue
(residue number reindexed from 1)		H25 R54 W58 Y64 E68 S71 Y75 H78 N79 V82 L83
External links