Structure of PDB 8jfu Chain B Binding Site BS01

Receptor Information
>8jfu Chain B (length=171) Species: 53344 (Staphylococcus delphini) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMRKTIERLLNSELSSNSIAVRTGVSQAVISKLRNGKKELGNLTLNSAEK
LFEYQKEMEKVDTWIVYRGRTADMNKSYIAEGSTYEEVYNNFVDKYGYDV
LDEDIYEIQLLKKNGENLDDYDVDSDGINNYDKLDEFRESDYVDLEDYDY
RELFENSSSQVYYHEFEITHE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jfu AcrIIA15 in complex with palindromic DNA substrate
Resolution3.15 Å
Binding residue
(original residue number in PDB)		S14 S15 N16 Q26 A27 S30 K31 N34 K36
Binding residue
(residue number reindexed from 1)		S15 S16 N17 Q27 A28 S31 K32 N35 K37
External links