Structure of PDB 8jd6 Chain B Binding Site BS01

Receptor Information
>8jd6 Chain B (length=301) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNK
VHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSREL
AGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMS
LSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGN
AFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGY
DDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIW
N
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jd6 Structural insights into dimerization and activation of the mGlu2-mGlu3 and mGlu2-mGlu4 heterodimers.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		R49 Y85 S281 G282 D323 G324 M325
Binding residue
(residue number reindexed from 1)		R10 Y46 S242 G243 D284 G285 M286
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0030159 signaling receptor complex adaptor activity
GO:0044877 protein-containing complex binding
GO:0051020 GTPase binding
Biological Process
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007191 adenylate cyclase-activating dopamine receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007213 G protein-coupled acetylcholine receptor signaling pathway
GO:0007265 Ras protein signal transduction
GO:0008283 cell population proliferation
GO:0050909 sensory perception of taste
GO:0060041 retina development in camera-type eye
GO:0071380 cellular response to prostaglandin E stimulus
GO:0071870 cellular response to catecholamine stimulus
Cellular Component
GO:0001750 photoreceptor outer segment
GO:0005737 cytoplasm
GO:0005765 lysosomal membrane
GO:0005829 cytosol
GO:0005834 heterotrimeric G-protein complex
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:0097381 photoreceptor disc membrane
GO:1903561 extracellular vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jd6, PDBe:8jd6, PDBj:8jd6
PDBsum8jd6
PubMed37286794
UniProtP62873|GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 (Gene Name=GNB1)

[Back to BioLiP]