Structure of PDB 8jbf Chain B Binding Site BS01

Receptor Information

>8jbf Chain B (length=282) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVTNYFLV
NLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYS
MTAIAVDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTK
VMPGRTLCFVQWPEGPKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLW
GEQLKAKRKVVKMMIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQV
YLASFWLAMSSTMYNPIIYCCLNKRFRAGFKR

Ligand information

>8jbf Chain A (length=7) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DDFFGLM

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8jbf Structural insights into neurokinin 3 receptor activation by endogenous and analogue peptide agonists.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	F78 Y145 L232 F234 Q236 H248 Y315 F319 N329 R330 Y338
Binding residue (residue number reindexed from 1)	F3 Y70 L157 F159 Q161 H173 Y228 F232 N242 R243 Y251

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004930	G protein-coupled receptor activity
GO:0004995	tachykinin receptor activity

	Biological Process
GO:0007186	G protein-coupled receptor signaling pathway

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8jbf, PDBe:8jbf, PDBj:8jbf
PDBsum	8jbf
PubMed	37391393
UniProt	P29371\|NK3R_HUMAN Neuromedin-K receptor (Gene Name=TACR3)

[Back to BioLiP]