Structure of PDB 8j92 Chain B Binding Site BS01

Receptor Information
>8j92 Chain B (length=83) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDA
VTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>8j92 Chain I (length=149) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccaggcctgagaatccggtgccgaggccgctcaattggtcgtagacagct
ctagcaccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgcc
aaggggattactccctagtctccaggcacgtgtcagatatatacatccg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8j92 Molecular and structural basis of the chromatin remodeling activity by Arabidopsis DDM1.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R35 R45 I46 G48 K79 T80
Binding residue
(residue number reindexed from 1)		R16 R26 I27 G29 K60 T61
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0009414 response to water deprivation
Cellular Component
GO:0000325 plant-type vacuole
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005777 peroxisome
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009506 plasmodesma
GO:0009507 chloroplast
GO:0009536 plastid
GO:0009579 thylakoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8j92, PDBe:8j92, PDBj:8j92
PDBsum8j92
PubMed38992002
UniProtP59259|H4_ARATH Histone H4 (Gene Name=At1g07660)

[Back to BioLiP]