Structure of PDB 8ir2 Chain B Binding Site BS01

Receptor Information
>8ir2 Chain B (length=198) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPKHIIQMTGFKMEEKEALVKLLLKLDCTFIKSEKYKNCTHLIAERLCKS
EKFLAACAAGKWILTKDYIIHSAKSGRWLDETTYEWGYKIEKDSRYSPQM
QSAPKRWREELKRTGAPGAFHRWKVVLLVRTDKRSDSLIRVLEAGKANVI
LPKSSPSGITHVIASNARIKAEKEKDNFKAPFYPIQYLGDFLLEKLEH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ir2 Structural insights into Rad18 targeting by the SLF1 BRCT domains.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		T13 G14 M17 K20 K36 E38 R50 K53 S54 K56 L58 Q190
Binding residue
(residue number reindexed from 1)		T9 G10 M13 K16 K32 E34 R46 K49 S50 K52 L54 Q186
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:2000781 positive regulation of double-strand break repair

View graph for
Biological Process
External links
PDB RCSB:8ir2, PDBe:8ir2, PDBj:8ir2
PDBsum8ir2
PubMed37748650
UniProtQ9BQI6|SLF1_HUMAN SMC5-SMC6 complex localization factor protein 1 (Gene Name=SLF1)

[Back to BioLiP]