Structure of PDB 8ipp Chain B Binding Site BS01

Receptor Information
>8ipp Chain B (length=126) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSDLGKKLLEAARAGQDDEVRILMANGADVNAKDRYGNTPLHLAAYMGHL
EIVEVLLKYGADVNAMDHWGRTPLHLAASRGHLDIVEVLLKHGADVNAQD
KFGKTAFDISIDNGNEDLAEILQKLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ipp Structural Basis for Parallel G-Quadruplex Recognition by an Ankyrin Protein.
Resolution2.007 Å
Binding residue
(original residue number in PDB)		R23 A24 Q26 R45 Y46 L53 Y56 M57 R81 R90
Binding residue
(residue number reindexed from 1)		R13 A14 Q16 R35 Y36 L43 Y46 M47 R71 R80
External links