Structure of PDB 8ijp Chain B Binding Site BS01

Receptor Information
>8ijp Chain B (length=152) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MESIQPWIEKFIKQAQQQRSQSTKDYPTSYRNLRVKLSFGYGNFTSIPWF
AFLGEGQEASNGIYPVIYYYKDFDELVLAYGISDTNEPHAQWQFSSDIPK
TIAEYFQATSGVYPKKYGQSYYACSQKVSQGIDYTRFASMLDNIINDYKL
IF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ijp Structural basis of target recognition by the DNA binding domain of McrBC
Resolution1.55 Å
Binding residue
(original residue number in PDB)
S38 G40 Y41 N43 T45 W49 A59 S60 Y64 S83 D84 T85 K116 Y117
Binding residue
(residue number reindexed from 1)
S38 G40 Y41 N43 T45 W49 A59 S60 Y64 S83 D84 T85 K116 Y117
Enzymatic activity
Enzyme Commision number 3.1.21.-
External links
PDB RCSB:8ijp, PDBe:8ijp, PDBj:8ijp
PDBsum8ijp
PubMed
UniProtP15005|MCRB_ECOLI Type IV methyl-directed restriction enzyme EcoKMcrB subunit (Gene Name=mcrB)

[Back to BioLiP]