Structure of PDB 8ij0 Chain B Binding Site BS01

Receptor Information
>8ij0 Chain B (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKI
QFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYH
LLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ij0 GAS41 promotes H2A.Z deposition through recognition of the N terminus of histone H3 by the YEATS domain.
Resolution1.52 Å
Binding residue
(original residue number in PDB)		E97 E109 R110 V112 L114 Y115 D140 E141 M142 I143 F144
Binding residue
(residue number reindexed from 1)		E81 E93 R94 V96 L98 Y99 D124 E125 M126 I127 F128
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:8ij0, PDBe:8ij0, PDBj:8ij0
PDBsum8ij0
PubMed37844223
UniProtO95619|YETS4_HUMAN YEATS domain-containing protein 4 (Gene Name=YEATS4)

[Back to BioLiP]