Structure of PDB 8id2 Chain B Binding Site BS01

Receptor Information
>8id2 Chain B (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FQGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGM
PAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERG
Ligand information
>8id2 Chain D (length=24) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggggacugcguucgcgcuuucccc
<<<<<..<<<....>>>..>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8id2 Structural insights into recognition of SL4, the UUCG stem-loop, of human U1 snRNA by the ubiquitin-like domain, including the C-terminal tail in the SF3A1 subunit of U2 snRNP.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		K756 F763 K765 K786 R788
Binding residue
(residue number reindexed from 1)		K56 F63 K65 K86 R88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0045292 mRNA cis splicing, via spliceosome

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8id2, PDBe:8id2, PDBj:8id2
PDBsum8id2
PubMed37094335
UniProtQ15459|SF3A1_HUMAN Splicing factor 3A subunit 1 (Gene Name=SF3A1)

[Back to BioLiP]