Structure of PDB 8ib1 Chain B Binding Site BS01

Receptor Information
>8ib1 Chain B (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLEQSGAEVKKPGSSVKVSCKASGPMFSRSAFSWVRQAPGQGLEWMGRI
IPTVDLKNYAQKFQGRVTFTADKSTATSYMELRSLKSEDTAVYYCARMGS
GSSYYGMDVWGLGTTVTVSSGASTKGPSVFPLAPSSGTAALGCLVKDYFP
EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN
VNHKPSNTKVDKRVEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ib1 Structural basis for cross-group recognition of an influenza virus hemagglutinin antibody that targets postfusion stabilized epitope.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		R75 I77 S126 G127 S128 S129 Y130
Binding residue
(residue number reindexed from 1)		R49 I51 S100 G101 S102 S103 Y104
External links