Structure of PDB 8ia4 Chain B Binding Site BS01

Receptor Information
>8ia4 Chain B (length=92) Species: 243275 (Treponema denticola ATCC 35405) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRVIVFFDLPVITPENRHNYSVFRKYLIKSGFIMQQKSVYSKLVLNLTNR
DSIVKSIEKNKPPEGLVEVLTVTEKQYAKMEIIIGESKTEYL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ia4 Insights into the inhibition of protospacer integration via interaction with Cas2 by an Anti-CRISPR protein
Resolution2.0 Å
Binding residue
(original residue number in PDB)		K55 E58 K59
Binding residue
(residue number reindexed from 1)		K55 E58 K59
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8ia4, PDBe:8ia4, PDBj:8ia4
PDBsum8ia4
PubMed38627399
UniProtQ73QW4|CAS2_TREDE CRISPR-associated endoribonuclease Cas2 (Gene Name=cas2)

[Back to BioLiP]