Structure of PDB 8i3f Chain B Binding Site BS01

Receptor Information
>8i3f Chain B (length=118) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENEDFCSACNQSGSFLCCDTCPKSFHFLCLDPPIDPNNLPKGDWHCNECK
FKIFINNSMATLKKIESNFIKQNNNVKIFAKLLFNIDSHNPKQFQLPNYI
KETFPAVKTGSRGQYSDE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i3f Molecular basis for Eaf3-mediated assembly of Rpd3S and NuA4.
Resolution1.62 Å
Binding residue
(original residue number in PDB)		N259 D261 S269 G270 S271 F272 L273 C274 C275 D276 P297 G299
Binding residue
(residue number reindexed from 1)		N2 D4 S12 G13 S14 F15 L16 C17 C18 D19 P40 G42
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8i3f, PDBe:8i3f, PDBj:8i3f
PDBsum8i3f
PubMed37236927
UniProtQ04779|RCO1_YEAST Transcriptional regulatory protein RCO1 (Gene Name=RCO1)

[Back to BioLiP]